PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cagra.16586s0001.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family bZIP
Protein Properties Length: 358aa    MW: 40173.5 Da    PI: 10.2589
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cagra.16586s0001.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_140.94.4e-13280331455
                           XCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                bZIP_1   4 lkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55 
                           +k+ +rk+kNRe+A rsR+RK+a++ eLe + ++L+++ ++L k+   l+k+
  Cagra.16586s0001.1.p 280 DKKLKRKIKNRESAARSRARKQAQTMELEAELEKLKKQYEELLKQQVDLRKM 331
                           699*************************************999887777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.9E-11276330No hitNo description
SMARTSM003383.5E-9277341IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.358279330IPR004827Basic-leucine zipper domain
PfamPF001701.5E-9280331IPR004827Basic-leucine zipper domain
CDDcd147076.68E-18281335No hitNo description
SuperFamilySSF579598.84E-10281331No hitNo description
PROSITE patternPS000360284299IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 358 aa     Download sequence    Send to blast
MDSYRRLKNL VNDLPVTNPS SRQGSSIYSW TVDQFQTSLG KNCGSMNMDE LVKNICSAEE  60
TQGALQRQGS TSLPRTLSHK TVDEVWKYIT QEEETKKYGV TNISHLQRQQ TLGEITLEEF  120
LIRSGARINN TSNVSIHDSS SLISGYPNTS LDVQFQPNAM VPMSHESNLH QNVNVSTMSA  180
YQPQQPIMSR PNSYSYGQQI RSSNGVQGNK RSLVPSVAKS PSGAMACSSV KPFPILNKTR  240
KIDGESSLLS PSPYIFSGNT STRGRKIDIN AITVENKLVD KKLKRKIKNR ESAARSRARK  300
QAQTMELEAE LEKLKKQYEE LLKQQVDLRK MLIEPGMINR QGGQEERKLR RTKSDIM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006281554.10.0hypothetical protein CARUB_v10027656mg
SwissprotQ9FMM71e-160AI5L8_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 8
TrEMBLR0EYV10.0R0EYV1_9BRAS; Uncharacterized protein
STRINGAl_scaffold_0008_7491e-159(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM156311417
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G42910.11e-127bZIP family protein